Products

View as table Download

Rabbit Polyclonal Anti-GM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS

Goat Anti-GM2A (aa 164-175) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-TTGNYRIESVLS, from the internal region of the protein sequence according to NP_000396.2.

Rabbit Polyclonal Anti-GM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL

Rabbit Polyclonal Anti-GM2A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GM2A antibody was raised against synthetic 15 amino acid peptide from internal region of human GM2A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Marmoset (93%).