Rabbit polyclonal anti-PPM1L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPM1L. |
Rabbit polyclonal anti-PPM1L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPM1L. |
Rabbit Polyclonal Anti-PPM1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PPM1L Antibody is: synthetic peptide directed towards the middle region of Human PPM1L. Synthetic peptide located within the following region: SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE |