USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EBNA1BP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBNA1BP2 antibody is: synthetic peptide directed towards the middle region of Human EBNA1BP2. Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP |
EBNA1BP2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human EBNA1BP2 (NP_006815.2). |
Modifications | Unmodified |