Products

View as table Download

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Biotinylated Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-IL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Rhesus Macaque, Cynomolgus Monkey, Human
Conjugation Unconjugated