Rabbit Polyclonal NALP1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1. |
Rabbit Polyclonal NALP1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NALP1 antibody was raised against a peptide corresponding to 13 amino acids near the carboxy-terminus of human NALP1. |
Rabbit Polyclonal Anti-NLRP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL |