Products

Jump to Filters
View as table Download
PSMB10 Goat Polyclonal Antibody
TA305923

USD 375.00

5 Days

Goat Anti-MECL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PTEPVKRSGRYH, from the internal region of the protein sequence according to NP_002792.1.
PSMB10 Rabbit Polyclonal Antibody
TA342171

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG