Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Products
View as table Download
Rabbit Polyclonal Anti-EBNA1BP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBNA1BP2 antibody is: synthetic peptide directed towards the middle region of Human EBNA1BP2. Synthetic peptide located within the following region: VTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLP |
EBNA1BP2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EBNA1BP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2 |
EBNA1BP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EBNA1BP2 |
EBNA1BP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human EBNA1BP2 (NP_006815.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EBNA1BP2
Reactivities
- Human
Conjugates
- Unconjugated