Goat Polyclonal Antibody against Flotillin 1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794. |
Goat Polyclonal Antibody against Flotillin 1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794. |
Rabbit Polyclonal Anti-FLOT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY |
Rabbit Polyclonal Anti-FLOT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the C-terminal region of Human FLOT1. Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER |
FLOT1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FLOT1 |
FLOT1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FLOT1 |
Flotillin 1 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-427 of human Flotillin 1 (NP_005794.1). |
Modifications | Unmodified |
Flotillin 1 Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Flotillin 1 |
Flotillin 1 Rabbit monoclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |