JUNB rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human JUNB |
JUNB rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human JUNB |
Rabbit anti-JUNB polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanJunB around the phosphorylation site of serine 259 (P-V-SP-P-I). |
Rabbit polyclonal JunB(Ser79) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunB around the phosphorylation site of Serine 79. |
Modifications | Phospho-specific |
Rabbit Polyclonal JunB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB |
Rabbit Polyclonal JunB (Ser259) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB around the phosphorylation site of Serine 259 |
Modifications | Phospho-specific |
Rabbit anti-JUNB (Phospho-Ser259) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 259 (P-V-SP-P-I). |
Modifications | Phospho-specific |
Goat Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKAENAGLSSTAG, from the internal region of the protein sequence according to NP_002220.1. |
Rabbit anti-JUNB (Phospho-Ser79) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 79 (G-A-SP-L-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKL |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF |
Rabbit Polyclonal Anti-JUNB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: VERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQ |
Rabbit anti JunB (pS259) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti JunB (pS79) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
JUNB rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human JUNB |
JunB Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human JunB (NP_002220.1). |
Modifications | Unmodified |
JunB Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human JunB (NP_002220.1). |
Modifications | Unmodified |
JunB Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human JunB |
JunB Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |