Products

View as table Download

Rabbit anti-RPL5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPL5

Rabbit polyclonal anti-RPL5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL5.

Rabbit polyclonal Anti-RPL5 Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP