Products

Jump to Filters
View as table Download
RPL5 Rabbit Polyclonal Antibody
TA332482

USD 275.00

3 Weeks

Rabbit anti-RPL5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPL5
RPL5 Rabbit Polyclonal Antibody
TA314454

USD 345.00

In Stock

Rabbit polyclonal anti-RPL5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL5.
RPL5 Rabbit Polyclonal Antibody
TA335158

USD 375.00

5 Days

Rabbit polyclonal Anti-Rpl5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG