Products

Jump to Filters
View as table Download
ABCA7 Rabbit Polyclonal Antibody
TA331841

USD 375.00

In Stock

Rabbit Polyclonal Anti-Abca7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
ABCA7 Rabbit Polyclonal Antibody
TA319812

USD 430.00

5 Days

Rabbit Polyclonal ABCA7 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7.
ABCA7 Rabbit Polyclonal Antibody
TA373122

USD 275.00

3 Weeks

ABCA7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCA7.