Products

View as table Download

Rabbit Polyclonal antibody to EMR1 (egf-like module containing, mucin-like, hormone receptor-like 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 626 and 886 of EMR1 (Uniprot ID#Q14246)

Rabbit polyclonal anti-EMR1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1.

Rabbit Polyclonal Anti-EMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG

Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%).

EMR1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-290 of human EMR1 (NP_001243182.1).
Modifications Unmodified

F4/80 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of Mouse F4/80.

Recombinant Anti-F4/80 (Clone Cl:A3-1 (recombinant version))

Applications FC, IHC
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-F4/80 (Clone Cl:A3-1 (recombinant version))

Applications FC, IHC
Reactivities Mouse
Conjugation Unconjugated