Products

View as table Download

Rabbit Polyclonal Anti-BAAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAAT antibody: synthetic peptide directed towards the N terminal of human BAAT. Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR

Rabbit Polyclonal Anti-BAAT Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BAAT

BAAT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human BAAT

BAAT Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 309-418 of human BAAT (NP_001692.1).
Modifications Unmodified