Products

View as table Download

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS

Rabbit Polyclonal Anti-Brd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Brd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Brd4. Synthetic peptide located within the following region: MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQSANAASTNPPPPET

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRD4

BRD4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human BRD4

BRD4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRD4

BRD4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human BRD4 (NP_490597.1).

BRD4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-794 of human BRD4 (NP_001317313.1).

BRD4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BRD4
Modifications Unmodified

Acetyl-BRD4-K332 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic acetylated peptide around K332 of human Acetyl-BRD4-K332.
Modifications Acetyl K332

BRD4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human BRD4 (NP_490597.1).
Modifications Unmodified

Phospho-BRD4-T204 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T204 of human Phospho-BRD4-T204.
Modifications Phospho T204

Recombinant Anti-BRD4 (Clone RAB-C131)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.