Products

View as table Download

Rabbit Polyclonal Anti-CYBA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP

Rabbit Polyclonal Anti-CYBA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBA