Rabbit Polyclonal DLK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1. |
Rabbit Polyclonal DLK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1. |
Rabbit Polyclonal Anti-DLK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
DLK1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLK1 |
DLK1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DLK1 |
Modifications | Unmodified |
DLK1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 83-383 of human DLK1 (NP_003827.3). |
Modifications | Unmodified |