Rabbit polyclonal Involucrin antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Involucrin. |
Rabbit polyclonal Involucrin antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Involucrin. |
Rabbit Polyclonal Anti-IVL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IVL antibody: synthetic peptide directed towards the N terminal of human IVL. Synthetic peptide located within the following region: AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE |
Rabbit Polyclonal Anti-Involucrin Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Involucrin Antibody: A synthesized peptide derived from human Involucrin |
Mouse monoclonal Anti-Involucrin Clone SY5
Reactivities | Human, Primate, Dog, Pig |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Involucrin Clone SY8
Reactivities | Human, Primate, Dog, Pig |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IVL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IVL |
IVL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2). |
Modifications | Unmodified |