Rabbit polyclonal anti-NT5C1A antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NT5C1A. |
Rabbit polyclonal anti-NT5C1A antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NT5C1A. |
Rabbit Polyclonal Anti-NT5C1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR |
Rabbit Polyclonal Anti-NT5C1A Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NT5C1A |
NT5C1A Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1A |