Rabbit Polyclonal Anti-PSMD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD8 antibody: synthetic peptide directed towards the C terminal of human PSMD8. Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV |
Anti-PSMD8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
PSMD8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-350 of human PSMD8 (NP_002803.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
