Products

View as table Download

Rabbit Polyclonal Anti-TAC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAC3 antibody: synthetic peptide directed towards the middle region of human TAC3. Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF

Neurokinin B, rabbit anti Neurokinin B, polyclonal.

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein.

Rabbit Polyclonal Neurokinin B Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal sequence of amino acids of the mouse proNKB protein (~93% homology to the rat sequence).

Rabbit polyclonal anti Neurokinin B; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein.

TAC3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of human TAC3 (NP_037383.1).
Modifications Unmodified