Products

View as table Download

UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal FLJ10808 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-UBA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS

UBA6 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UBA6

UBA6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UBA6

UBA6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UBA6

UBA6 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UBA6 (NP_060697.4).
Modifications Unmodified