Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
GLI3 (NM_000168) Human Tagged ORF Clone
RC216945

USD 1,660.00

In Stock

GLI3 (Myc-DDK-tagged)-Human GLI family zinc finger 3 (GLI3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GLI3 (NM_000168) Human Tagged ORF Clone
RG216945

USD 1,830.00

In Stock

GLI3 (GFP-tagged) - Human GLI family zinc finger 3 (GLI3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLI3 (NM_000168) Human Tagged ORF Clone
RC216945L3

USD 1,860.00

3 Weeks

Lenti-ORF clone of GLI3 (Myc-DDK-tagged)-Human GLI family zinc finger 3 (GLI3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GLI3 (NM_000168) Human Tagged ORF Clone Lentiviral Particle
RC216945L4V

USD 2,060.00

6 Weeks

Lenti ORF particles, GLI3 (mGFP-tagged)-Human GLI family zinc finger 3 (GLI3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLI3 (NM_000168) Human Tagged ORF Clone
RC216945L4

USD 2,304.00

In Stock

Lenti-ORF clone of GLI3 (mGFP-tagged)-Human GLI family zinc finger 3 (GLI3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLI3 (NM_000168) Human Untagged Clone
SC309064

USD 1,100.00

In Stock

GLI3 (untagged)-Human GLI family zinc finger 3 (GLI3)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GLI3 Rabbit Polyclonal Antibody
TA319303

USD 530.00

2 Weeks

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.
GLI3 Rabbit Polyclonal Antibody
TA313928

USD 345.00

4 Weeks

Rabbit polyclonal anti-GLI-3 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3.
GLI3 Rabbit Polyclonal Antibody
TA355523

USD 360.00

5 Days

GLI3 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC
GLI3 ICC Control Block
TB416945

USD 2,310.00

4 Weeks

Transient overexpression of GLI3 (NM_000168) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GLI3 Cytosection
TS416945

USD 225.00

4 Weeks

Transient overexpression of GLI3 (NM_000168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GLI3 Cytosection
TS416945P5

USD 889.00

4 Weeks

Transient overexpression of GLI3 (NM_000168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack