Products

cDNA Clones (91)
Proteins (45)
Antibodies (7)
Jump to Filters
View as table Download
Aspartate beta hydroxylase (ASPH) (NM_001164752) Human Tagged ORF Clone Lentiviral Particle
RC228210L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (Myc-DDK tagged) - Human aspartate beta-hydroxylase (ASPH), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164752) Human Tagged ORF Clone Lentiviral Particle
RC228210L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (mGFP-tagged) - Human aspartate beta-hydroxylase (ASPH), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164754) Human Tagged ORF Clone Lentiviral Particle
RC228230L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (Myc-DDK tagged) - Human aspartate beta-hydroxylase (ASPH), transcript variant 10, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164754) Human Tagged ORF Clone Lentiviral Particle
RC228230L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (mGFP-tagged) - Human aspartate beta-hydroxylase (ASPH), transcript variant 10, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164751) Human Tagged ORF Clone Lentiviral Particle
RC228231L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (Myc-DDK-tagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164751) Human Tagged ORF Clone Lentiviral Particle
RC228231L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASPH (mGFP-tagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164750) Human Tagged ORF Clone Lentiviral Particle
RC228556L3V

USD 1,210.00

7 Weeks

Lenti ORF particles, ASPH (Myc-DDK-tagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_001164750) Human Tagged ORF Clone Lentiviral Particle
RC228556L4V

USD 1,210.00

7 Weeks

Lenti ORF particles, ASPH (mGFP-tagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspartate beta hydroxylase (ASPH) (NM_004318) Human Untagged Clone
SC314625

USD 1,550.00

In Stock

ASPH (untagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA337291

USD 375.00

In Stock

Rabbit Polyclonal Anti-ASPH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA339207

USD 310.00

In Stock

Rabbit Polyclonal Anti-ASPH

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
Aspartate beta hydroxylase (ASPH) (Center) Rabbit Polyclonal Antibody
AP50276PU-N

USD 450.00

2 Weeks

Aspartate beta hydroxylase (ASPH) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 301-331 amino acids from the Central region of human ASPH
Aspartate beta hydroxylase (ASPH) (NM_004318) Human Over-expression Lysate
LY418063

USD 605.00

5 Days

Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA335749

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASPH Antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNK
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA335750

USD 310.00

5 Days

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASPH Antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: ETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAV
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA339206

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASPH

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA343455

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLS
ASPH (75-270, His-tag) Human Protein
AR09383PU-L

USD 1,105.00

2 Weeks

ASPH (75-270, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ASPH (75-270, His-tag) Human Protein
AR09383PU-N

USD 415.00

2 Weeks

ASPH (75-270, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Aspartate beta hydroxylase (ASPH) (NM_032466) Human Over-expression Lysate
LY410099

USD 396.00

5 Days

Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aspartate beta hydroxylase (ASPH) (NM_032468) Human Over-expression Lysate
LY410101

USD 396.00

5 Days

Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aspartate beta hydroxylase (ASPH) (NM_001164752) Human Over-expression Lysate
LY431238

USD 396.00

5 Days

Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 8

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB