Germany
Japan
United Kingdom
China
RBL2 (Myc-DDK-tagged)-Human retinoblastoma-like 2 (p130) (RBL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Homo sapiens retinoblastoma-like 2 (p130) (RBL2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,430.00
3 Weeks
Lenti ORF particles, RBL2 (Myc-DDK tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,430.00
6 Weeks
Lenti ORF particles, RBL2 (mGFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RBL2 (GFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,430.00
7 Weeks
Lenti ORF particles, RBL2 (Myc-DDK tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,430.00
7 Weeks
Lenti ORF particles, RBL2 (mGFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RBL2 (untagged)-Human retinoblastoma-like 2 (p130) (RBL2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RBL2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rb2 p130 (RBL2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 164-195 amino acids from the N-terminal region of Human RBL2. |
Rabbit polyclonal anti-p130 Rb2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rb2 (p130) peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal pRb2 p130 antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit Polyclonal anti-RBL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES |
Rabbit Polyclonal Anti-RBL2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD |
Transient overexpression lysate of retinoblastoma-like 2 (p130) (RBL2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RBL2 MS Standard C13 and N15-labeled recombinant protein (NP_005602)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RBL2
Families
- Druggable Genome
Pathways
- Cell cycle