GSTM1 (Myc-DDK-tagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTM1 (Myc-DDK-tagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTM1 (Myc-DDK-tagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTM1 (GFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GSTM1 (Myc-DDK tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GSTM1 (mGFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GSTM1 (GFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTM1 (Myc-DDK tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTM1 (mGFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTM1 (Myc-DDK tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTM1 (mGFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to GSTM1 (glutathione S-transferase mu 1)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 189 of GSTM1 |
GSTM1 (untagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GSTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Rabbit Polyclonal Anti-GSTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal GSTM1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Purified recombinant protein of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1 |
GSTM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GSTM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GSTM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Transient overexpression lysate of glutathione S-transferase mu 1 (GSTM1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against GSTM1 / GSTM2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CVFSKMAVWGNK, from the C Terminus of the protein sequence according to NP_000552; NP_666533; NP_000839. |
GSTM1 (1-181, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
GSTM1 (1-181, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of glutathione S-transferase mu 1 (GSTM1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GSTM1 (untagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GSTM1 (NM_146421) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTM1 (NM_000561) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTM1 (NM_146421) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTM1 (NM_146421) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GSTM1 (NM_000561) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTM1 (NM_000561) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack