BMP6 (Myc-DDK-tagged)-Human bone morphogenetic protein 6 (BMP6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
BMP6 (Myc-DDK-tagged)-Human bone morphogenetic protein 6 (BMP6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BMP6 (Myc-DDK tagged) - Human bone morphogenetic protein 6 (BMP6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, BMP6 (mGFP-tagged) - Human bone morphogenetic protein 6 (BMP6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Purified recombinant protein of Homo sapiens bone morphogenetic protein 6 (BMP6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
BMP6 (GFP-tagged) - Human bone morphogenetic protein 6 (BMP6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BMP6 (Myc-DDK tagged) - Human bone morphogenetic protein 6 (BMP6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BMP6 (mGFP-tagged) - Human bone morphogenetic protein 6 (BMP6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
BMP6 (untagged)-Human bone morphogenetic protein 6 (BMP6)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
Lenti ORF clone of Human bone morphogenetic protein 6 (BMP6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Lenti ORF clone of Human bone morphogenetic protein 6 (BMP6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human bone morphogenetic protein 6 (BMP6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Purified recombinant protein of Human bone morphogenetic protein 6 (BMP6).
Tag | Tag Free |
Expression Host | HEK293 |
Transient overexpression lysate of bone morphogenetic protein 6 (BMP6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Lenti ORF clone of Human bone morphogenetic protein 6 (BMP6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
BMP6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal anti-BMP-6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human BMP-6 |
BMP6 (375-513, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
BMP6 (375-513, His-tag) human recombinant protein, 20 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 MS Standard C13 and N15-labeled recombinant protein (NP_001709)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-BMP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP6 |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BMP6 mouse monoclonal antibody,clone OTI1B11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI1B11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI4A3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BMP6 mouse monoclonal antibody,clone OTI8B11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI8B11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
BMP6 mouse monoclonal antibody,clone OTI6G9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of BMP6 (NM_001718) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BMP6 (NM_001718) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BMP6 (NM_001718) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack