Products

View as table Download

CYP2C9 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CYP2C9 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP2C9 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYP2C9 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

CYP2C9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 9 (CYP2C9), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CYP2C9 (untagged)-Homo sapiens, Similar to cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 9, clone MGC:22601 IMAGE:4766890, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP2C9 MS Standard C13 and N15-labeled recombinant protein (NP_000762)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CYP2C9 (NM_000771) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack