AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2) |
AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AHCYL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE |
AHCYL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AHCYL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AHCYL2 MS Standard C13 and N15-labeled recombinant protein (NP_001124192)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack