Products

cDNA Clones (7)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
ANXA2R (NM_001014279) Human Tagged ORF Clone
RC209862

USD 98.00

USD 390.00

In Stock

ANXA2R (Myc-DDK-tagged)-Human chromosome 5 open reading frame 39 (C5orf39)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ANXA2R (NM_001014279) Human Tagged ORF Clone
RG209862

USD 460.00

In Stock

ANXA2R (GFP-tagged) - Human chromosome 5 open reading frame 39 (C5orf39)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ANXA2R (NM_001014279) Human Tagged ORF Clone
RC209862L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 5 open reading frame 39 (C5orf39), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ANXA2R (NM_001014279) Human Tagged ORF Clone
RC209862L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chromosome 5 open reading frame 39 (C5orf39), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ANXA2R (NM_001014279) Human Over-expression Lysate
LY423048

USD 396.00

In Stock

Transient overexpression lysate of chromosome 5 open reading frame 39 (C5orf39)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ANXA2R Rabbit Polyclonal Antibody
TA334944

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ANXA2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
ANXA2R (NM_001014279) Human Recombinant Protein
TP761402

USD 215.00

In Stock

Purified recombinant protein of Human chromosome 5 open reading frame 39 (C5orf39), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
ANXA2R (NM_001014279) Human Over-expression Lysate
LC423048

USD 121.00

2 Weeks

ANXA2R HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ANXA2R (NM_001014279) Human Untagged Clone
SC301918

USD 420.00

3 Weeks

ANXA2R (untagged)-Human chromosome 5 open reading frame 39 (C5orf39)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ANXA2R Rabbit Polyclonal Antibody
TA350997

USD 345.00

In Stock

Rabbit Polyclonal Anti-ANXA2R Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANXA2R
ANXA2R ICC Control Block
TB409862

USD 1,040.00

4 Weeks

Transient overexpression of ANXA2R (NM_001014279) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ANXA2R Cytosection
TS409862

USD 225.00

4 Weeks

Transient overexpression of ANXA2R (NM_001014279) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ANXA2R Cytosection
TS409862P5

USD 889.00

4 Weeks

Transient overexpression of ANXA2R (NM_001014279) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack