Products

View as table Download

CD40LG (Myc-DDK-tagged)-Human CD40 ligand (CD40LG)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CD40LG (untagged)-Human CD40 ligand (CD40LG)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CD40LG (GFP-tagged) - Human CD40 ligand (CD40LG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

Purified recombinant protein of Human CD40 ligand (CD40LG).

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Human CD40 ligand (CD40LG / TNFSF5)

Tag N-His
Expression Host HEK293

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

Lenti ORF clone of Human CD40 ligand (CD40LG), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Lenti ORF clone of Human CD40 ligand (CD40LG), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CD40L (CD40LG) (C-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP

CD40LG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified

Applications FC
Reactivities Human

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE

Applications FC
Reactivities Human
Conjugation PE

CD40L (CD40LG) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP

Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit anti CD154 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to aa 51-69 of human CD154.

CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

CD154 / CD40L (113-261, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

CD40LG (untagged)-Human CD40 ligand (CD40LG)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CD40LG

CD40L biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600027

Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261

Tag tag free
Expression Host E. coli

Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261

Tag tag free
Expression Host E. coli

Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261

Tag tag free
Expression Host E. coli

Recombinant protein of human CD40 ligand (CD40LG), the domain of Met113-Leu261

Tag tag free
Expression Host E. coli

Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CD40LG (NM_000074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack