Products

cDNA Clones (46)
Proteins (25)
Antibodies (5)
Jump to Filters
View as table Download
CNBP (NM_003418) Human Tagged ORF Clone
RC214473

USD 98.00

USD 390.00

In Stock

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CNBP (NM_001127196) Human Tagged ORF Clone
RC225167

USD 420.00

In Stock

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CNBP (NM_003418) Human Tagged ORF Clone Lentiviral Particle
RC214473L1V

USD 820.00

3 Weeks

Lenti ORF particles, CNBP (Myc-DDK tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CNBP (NM_003418) Human Tagged ORF Clone Lentiviral Particle
RC214473L2V

USD 820.00

6 Weeks

Lenti ORF particles, CNBP (mGFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CNBP (NM_001127192) Human Tagged ORF Clone
RC225190

USD 420.00

In Stock

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127192) Human Tagged ORF Clone
RG225190

USD 460.00

In Stock

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_003418) Human Tagged ORF Clone
RG214473

USD 460.00

In Stock

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_003418) Human Tagged ORF Clone
RC214473L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_003418) Human Tagged ORF Clone Lentiviral Particle
RC214473L3V

USD 820.00

5 Weeks

Lenti ORF particles, CNBP (Myc-DDK tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_003418) Human Tagged ORF Clone
RC214473L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_003418) Human Tagged ORF Clone Lentiviral Particle
RC214473L4V

USD 820.00

7 Weeks

Lenti ORF particles, CNBP (mGFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127196) Human Tagged ORF Clone
RC225167L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127196) Human Tagged ORF Clone Lentiviral Particle
RC225167L3V

USD 820.00

6 Weeks

Lenti ORF particles, CNBP (Myc-DDK tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127196) Human Tagged ORF Clone
RC225167L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127196) Human Tagged ORF Clone Lentiviral Particle
RC225167L4V

USD 820.00

6 Weeks

Lenti ORF particles, CNBP (mGFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127195) Human Tagged ORF Clone
RC225168

USD 420.00

2 Weeks

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127195) Human Tagged ORF Clone
RC225168L3

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127195) Human Tagged ORF Clone Lentiviral Particle
RC225168L3V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127195) Human Tagged ORF Clone
RC225168L4

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127195) Human Tagged ORF Clone Lentiviral Particle
RC225168L4V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127194) Human Tagged ORF Clone
RC225174

USD 420.00

2 Weeks

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127194) Human Tagged ORF Clone
RC225174L3

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127194) Human Tagged ORF Clone Lentiviral Particle
RC225174L3V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127194) Human Tagged ORF Clone
RC225174L4

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127194) Human Tagged ORF Clone Lentiviral Particle
RC225174L4V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127193) Human Tagged ORF Clone
RC225188

USD 420.00

2 Weeks

CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127193) Human Tagged ORF Clone
RC225188L3

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127193) Human Tagged ORF Clone Lentiviral Particle
RC225188L3V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127193) Human Tagged ORF Clone
RC225188L4

USD 620.00

8 Weeks

Lenti-ORF clone of CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127193) Human Tagged ORF Clone Lentiviral Particle
RC225188L4V

USD 820.00

11 Weeks

Lenti ORF particles, CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127192) Human Tagged ORF Clone
RC225190L3

USD 620.00

3 Weeks

Lenti-ORF clone of CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127192) Human Tagged ORF Clone Lentiviral Particle
RC225190L3V

USD 820.00

6 Weeks

Lenti ORF particles, CNBP (Myc-DDK-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127192) Human Tagged ORF Clone
RC225190L4

USD 620.00

3 Weeks

Lenti-ORF clone of CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127192) Human Tagged ORF Clone Lentiviral Particle
RC225190L4V

USD 820.00

6 Weeks

Lenti ORF particles, CNBP (mGFP-tagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNBP (NM_001127196) Human Tagged ORF Clone
RG225167

USD 460.00

3 Weeks

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127195) Human Tagged ORF Clone
RG225168

USD 460.00

3 Weeks

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127194) Human Tagged ORF Clone
RG225174

USD 460.00

3 Weeks

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_001127193) Human Tagged ORF Clone
RG225188

USD 460.00

3 Weeks

CNBP (GFP-tagged) - Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNBP (NM_003418) Human Tagged ORF Clone
RC214473L1

USD 768.00

In Stock

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-N

USD 340.00

2 Weeks

CNBP mouse monoclonal antibody, clone AT38F10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-S

USD 230.00

2 Weeks

CNBP mouse monoclonal antibody, clone AT38F10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
CNBP (NM_003418) Human Tagged ORF Clone
RC214473L2

USD 620.00

3 Weeks

Lenti ORF clone of Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CNBP (NM_003418) Human Untagged Clone
SC118022

USD 420.00

In Stock

CNBP (untagged)-Human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CNBP (NM_003418) Human Over-expression Lysate
LC418710

USD 121.00

In Stock

CNBP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CNBP Rabbit Polyclonal Antibody
TA324700

USD 450.00

5 Days

Rabbit polyclonal CNBP Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This CNBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-118 amino acids from the Central region of human CNBP.
CNBP (NM_003418) Human Over-expression Lysate
LY418710

USD 396.00

5 Days

Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CNBP Goat Polyclonal Antibody
TA303103

USD 375.00

5 Days

Goat Polyclonal Antibody against CNBP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GESGHLARECTIE, from the C Terminus of the protein sequence according to NP_003409.1.
CNBP Rabbit Polyclonal Antibody
TA338232

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNBP antibody: synthetic peptide directed towards the N terminal of human CNBP. Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP
CNBP (1-170, His-tag) Human Protein
AR50802PU-N

USD 845.00

2 Weeks

CNBP (1-170, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CNBP (1-170, His-tag) Human Protein
AR50802PU-S

USD 330.00

2 Weeks

CNBP (1-170, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli