CSNK1A1L (Myc-DDK-tagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK1A1L (Myc-DDK-tagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CSNK1A1L (Myc-DDK tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CSNK1A1L (mGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CSNK1A1L (GFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CSNK1A1L (Myc-DDK tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CSNK1A1L (mGFP-tagged) - Human casein kinase 1, alpha 1-like (CSNK1A1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Recombinant protein of human casein kinase 1, alpha 1-like (CSNK1A1L), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
CSNK1A1L (untagged)-Human casein kinase 1, alpha 1-like (CSNK1A1L)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-CKI-a1/L antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L. |
Lenti ORF clone of Human casein kinase 1, alpha 1-like (CSNK1A1L), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CSNK1A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD |
CSNK1A1L HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of casein kinase 1, alpha 1-like (CSNK1A1L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CSNK1A1L (NM_145203) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack