Germany
Japan
United Kingdom
China
CYP2A13 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, CYP2A13 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYP2A13 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2A13 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYP2A13 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYP2A13 (GFP-tagged) - Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CYP2A13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2A13 antibody: synthetic peptide directed towards the C terminal of human CYP2A13. Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF |
CYP2A13 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13. |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Cytochrome P450 2A13 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2A13. |
CYP2A13 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13 |
CYP2A13 (untagged)-Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of CYP2A13 (NM_000766) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2A13 (NM_000766) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2A13 (NM_000766) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYP2A13
Families
- Druggable Genome