Products

cDNA Clones (10)
Antibodies (7)
Proteins (5)
Jump to Filters
View as table Download
Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Tagged ORF Clone Lentiviral Particle
RC210811L3V

USD 820.00

3 Weeks

Lenti ORF particles, GIPR (Myc-DDK tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Tagged ORF Clone Lentiviral Particle
RC210811L4V

USD 820.00

3 Weeks

Lenti ORF particles, GIPR (mGFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Tagged ORF Clone
RC210811L3

USD 768.00

In Stock

Lenti ORF clone of Human gastric inhibitory polypeptide receptor (GIPR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA313923

USD 345.00

In Stock

Rabbit polyclonal anti-GIPR antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA324940

USD 450.00

5 Days

Rabbit polyclonal GIPR Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) Rabbit Polyclonal Antibody
AP18034PU-N

USD 450.00

2 Weeks

Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 113~142 amino acids from the Center region of Human GIPR.
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA340918

USD 425.00

5 Days

Rabbit Polyclonal Anti-GIPR Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GIPR / GIP Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GIPR. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Panda, Dog, Bat (94%); Bovine, Rabbit, Horse (89%).
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA343348

USD 375.00

5 Days

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA
Gastric Inhibitory Polypeptide Receptor (GIPR) Rabbit Polyclonal Antibody
TA350912

USD 345.00

In Stock

Rabbit Polyclonal Anti-GIPR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GIPR
Gastric Inhibitory Polypeptide Receptor (GIPR) ICC Control Block
TB410811

USD 1,070.00

4 Weeks

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Gastric Inhibitory Polypeptide Receptor (GIPR) Cytosection
TS410811

USD 225.00

4 Weeks

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Gastric Inhibitory Polypeptide Receptor (GIPR) Cytosection
TS410811P5

USD 889.00

4 Weeks

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack