Products

View as table Download

NODAL (Myc-DDK-tagged)-Human nodal homolog (mouse) (NODAL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

NODAL (GFP-tagged) - Human nodal homolog (mouse) (NODAL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human nodal homolog (mouse) (NODAL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nodal homolog (mouse) (NODAL), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human nodal homolog (mouse) (NODAL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

NODAL (untagged)-Human nodal homolog (mouse) (NODAL)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-NODAL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the middle region of human NODAL. Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH

Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Purified recombinant protein of Human nodal homolog (mouse) (NODAL), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

Lenti ORF clone of Human nodal homolog (mouse) (NODAL), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Monoclonal Antibody against NODAL (Clone EP2058Y)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

NODAL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Anti-NODAL Goat Polyclonal Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig
Immunogen NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%).

Goat Anti-NODAL Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ECPNPVGEEFH, from the internal region of the protein sequence according to NP_060525.2.

USD 1,070.00

4 Weeks

Transient overexpression of NODAL (NM_018055) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of NODAL (NM_018055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of NODAL (NM_018055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack