RBL2 (Myc-DDK-tagged)-Human retinoblastoma-like 2 (p130) (RBL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RBL2 (Myc-DDK-tagged)-Human retinoblastoma-like 2 (p130) (RBL2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Homo sapiens retinoblastoma-like 2 (p130) (RBL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,430.00
3 Weeks
Lenti ORF particles, RBL2 (Myc-DDK tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,430.00
6 Weeks
Lenti ORF particles, RBL2 (mGFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RBL2 (GFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,430.00
7 Weeks
Lenti ORF particles, RBL2 (Myc-DDK tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,430.00
7 Weeks
Lenti ORF particles, RBL2 (mGFP-tagged) - Human retinoblastoma-like 2 (p130) (RBL2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RBL2 (untagged)-Human retinoblastoma-like 2 (p130) (RBL2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Monoclonal Antibody against RBL2 (Clone EP2141Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Lenti ORF clone of Human retinoblastoma-like 2 (p130) (RBL2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RBL2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rb2 p130 (RBL2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 164-195 amino acids from the N-terminal region of Human RBL2. |
Rabbit polyclonal anti-p130 Rb2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rb2 (p130) peptide corresponding to a region near the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal pRb2 p130 antibody
Applications | WB |
Reactivities | Chimpanzee, Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit Polyclonal anti-RBL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES |
Rabbit Polyclonal Anti-RBL2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD |
Transient overexpression lysate of retinoblastoma-like 2 (p130) (RBL2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RBL2 MS Standard C13 and N15-labeled recombinant protein (NP_005602)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RBL2 (NM_005611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack