Germany
Japan
United Kingdom
China
DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
DLL1 (GFP-tagged) - Human delta-like 1 (Drosophila) (DLL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DLL1 (untagged)-Human delta-like 1 (Drosophila) (DLL1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of delta-like 1 (Drosophila) (DLL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human delta-like 1 (Drosophila) (DLL1).
| Tag | Tag Free |
| Expression Host | HEK293 |
DLL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Goat Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
DLL1 MS Standard C13 and N15-labeled recombinant protein (NP_005609)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DLL1
Families
- ES Cell Differentiation/IPS