Products

View as table Download

DLL1 (Myc-DDK-tagged)-Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, DLL1 (Myc-DDK tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

DLL1 (GFP-tagged) - Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, DLL1 (mGFP-tagged) - Human delta-like 1 (Drosophila) (DLL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

DLL1 (untagged)-Human delta-like 1 (Drosophila) (DLL1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human delta-like 1 (Drosophila) (DLL1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human delta-like 1 (Drosophila) (DLL1).

Tag Tag Free
Expression Host HEK293

DLL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-DLL1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Goat Anti-DLL1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3.

DLL1 MS Standard C13 and N15-labeled recombinant protein (NP_005609)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of DLL1 (NM_005618) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack