Germany
Japan
United Kingdom
China
MAFA (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MAFA (GFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAFA (untagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, MAFA (mGFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, MAFA (Myc-DDK tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAFA (Myc-DDK tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAFA (mGFP-tagged) - Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MAFA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MAFA (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA. |
MAFA (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 285-315 amino acids from the C-terminal region of human MAFA |
MAFA (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 288~318 amino acids from the C-terminal region of human MAFA |
Transient overexpression lysate of v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) (MAFA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MAFA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA |
Rabbit Polyclonal Anti-MAFA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS |
Transient overexpression of MAFA (NM_201589) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAFA (NM_201589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAFA (NM_201589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAFA
Families
- ES Cell Differentiation/IPS