BMP7 (untagged)-Human bone morphogenetic protein 7 (BMP7)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
BMP7 (untagged)-Human bone morphogenetic protein 7 (BMP7)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
BMP7 (Myc-DDK-tagged)-Human bone morphogenetic protein 7 (BMP7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
BMP7 (GFP-tagged) - Human bone morphogenetic protein 7 (BMP7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BMP7 (Myc-DDK tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, BMP7 (mGFP-tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, BMP7 (Myc-DDK tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BMP7 (mGFP-tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human bone morphogenetic protein 7 (BMP7).
Tag | Tag Free |
Expression Host | CHO |
Transient overexpression lysate of bone morphogenetic protein 7 (BMP7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
BMP7 human recombinant protein, 10 µg
Expression Host | CHO |
BMP7 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide cooresponding aa 140-190 of human BMP7 |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cells derived Recombinant Human BMP-7 |
BMP7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-BMP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
BMP7 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
BMP7 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
Rabbit anti-BMP7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP7 |
BMP7 (293-431, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
BMP7 (293-431, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack