BMP8B (Myc-DDK-tagged)-Human bone morphogenetic protein 8b (BMP8B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
BMP8B (Myc-DDK-tagged)-Human bone morphogenetic protein 8b (BMP8B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BMP8B (Myc-DDK tagged) - Human bone morphogenetic protein 8b (BMP8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, BMP8B (mGFP-tagged) - Human bone morphogenetic protein 8b (BMP8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
BMP8B (GFP-tagged) - Human bone morphogenetic protein 8b (BMP8B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human bone morphogenetic protein 8b (BMP8B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BMP8B (Myc-DDK tagged) - Human bone morphogenetic protein 8b (BMP8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human bone morphogenetic protein 8b (BMP8B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BMP8B (mGFP-tagged) - Human bone morphogenetic protein 8b (BMP8B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human bone morphogenetic protein 8b (BMP8B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human bone morphogenetic protein 8b (BMP8B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-BMP8B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BMP8B. |
BMP8B mouse monoclonal antibody, clone AT13E6, Purified
Applications | ELISA, WB |
Reactivities | Human |
BMP8B mouse monoclonal antibody, clone AT13E6, Purified
Applications | ELISA, WB |
Reactivities | Human |
BMP8B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of bone morphogenetic protein 8b (BMP8B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
BMP8B rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
BMP8B (untagged)-Human bone morphogenetic protein 8b (BMP8B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-BMP8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP8B antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8B. Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL |
BMP8B (264-402, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
BMP8B (264-402, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of BMP8B (NM_001720) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BMP8B (NM_001720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BMP8B (NM_001720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack