Products

cDNA Clones (11)
Proteins (9)
Antibodies (6)
Jump to Filters
View as table Download
BMP7 (NM_001719) Human Untagged Clone
SC119058

USD 310.00

In Stock

BMP7 (untagged)-Human bone morphogenetic protein 7 (BMP7)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
BMP7 (NM_001719) Human Tagged ORF Clone
RC203813

USD 420.00

In Stock

BMP7 (Myc-DDK-tagged)-Human bone morphogenetic protein 7 (BMP7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BMP7 (NM_001719) Human Tagged ORF Clone
RG203813

USD 460.00

In Stock

BMP7 (GFP-tagged) - Human bone morphogenetic protein 7 (BMP7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BMP7 (NM_001719) Human Tagged ORF Clone Lentiviral Particle
RC203813L1V

USD 820.00

3 Weeks

Lenti ORF particles, BMP7 (Myc-DDK tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BMP7 (NM_001719) Human Tagged ORF Clone Lentiviral Particle
RC203813L2V

USD 820.00

3 Weeks

Lenti ORF particles, BMP7 (mGFP-tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
BMP7 (NM_001719) Human Tagged ORF Clone Lentiviral Particle
RC203813L3V

USD 820.00

5 Weeks

Lenti ORF particles, BMP7 (Myc-DDK tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BMP7 (NM_001719) Human Tagged ORF Clone Lentiviral Particle
RC203813L4V

USD 820.00

3 Weeks

Lenti ORF particles, BMP7 (mGFP-tagged) - Human bone morphogenetic protein 7 (BMP7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BMP7 (NM_001719) Human Tagged Lenti ORF Clone
RC203813L1

USD 768.00

In Stock

Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BMP7 (NM_001719) Human Recombinant Protein
TP723047

USD 240.00

2 Weeks

Purified recombinant protein of Human bone morphogenetic protein 7 (BMP7).

Tag Tag Free
Expression Host CHO
BMP7 (NM_001719) Human Over-expression Lysate
LY400647

USD 396.00

5 Days

Transient overexpression lysate of bone morphogenetic protein 7 (BMP7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BMP7 (NM_001719) Human Tagged ORF Clone
RC203813L2

USD 620.00

In Stock

Lenti ORF clone of Human bone morphogenetic protein 7 (BMP7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BMP7 Human Protein
AR31155PU-N

USD 340.00

2 Weeks

BMP7 human recombinant protein, 10 µg

Expression Host CHO
BMP7 Rabbit Polyclonal Antibody
AP20768PU-N

USD 407.00

2 Weeks

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7
BMP7 Rabbit Polyclonal Antibody
TA328272

USD 285.00

5 Days

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7
BMP7 (NM_001719) Human Over-expression Lysate
LC400647

USD 121.00

In Stock

BMP7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
BMP7 Rabbit Polyclonal Antibody
TA330253

USD 310.00

5 Days

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
BMP7 Rabbit Polyclonal Antibody
AP31724PU-L

USD 385.00

2 Weeks

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.
BMP7 Rabbit Polyclonal Antibody
AP31724PU-N

USD 280.00

2 Weeks

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.
BMP7 Rabbit Polyclonal Antibody
TA326853

USD 345.00

3 Weeks

Rabbit anti-BMP7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7
BMP7 (293-431, His-tag) Human Protein
AR09130PU-L

USD 620.00

2 Weeks

BMP7 (293-431, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
BMP7 (293-431, His-tag) Human Protein
AR09130PU-N

USD 260.00

2 Weeks

BMP7 (293-431, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
BMP7 ICC Control Block
TB403813

USD 1,070.00

4 Weeks

Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BMP7 Cytosection
TS403813

USD 225.00

4 Weeks

Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BMP7 Cytosection
TS403813P5

USD 889.00

4 Weeks

Transient overexpression of BMP7 (NM_001719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack