Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 (Myc-DDK-tagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (Myc-DDK tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, LPAR6 (mGFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LPAR6 Mutant (S3T), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | S3T |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (D63V), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | D63V |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (G146R), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | G146R |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (Q155X), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | Q155X |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (I188F), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | I188F |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (E189K), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | E189K |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 Mutant (C278Y), Myc-DDK-tagged ORF clone of Homo sapiens lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1 as transfection-ready DNA
Mutation | C278Y |
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LPAR6 (GFP-tagged) - Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6 |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysophosphatidic acid receptor 6 (LPAR6), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-LPAR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human LPAR6. Synthetic peptide located within the following region: VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR |
Rabbit Polyclonal Anti-LPAR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK |
Rabbit Polyclonal Anti-LPAR6 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Rat, Hamster, Rabbit (88%); Bat (81%). |
Rabbit Polyclonal Anti-LPAR6 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Hamster, Elephant (100%); Monkey, Rat, Panda, Bovine, Rabbit (94%); Horse (88%). |
LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
LPAR6 (untagged)-Human lysophosphatidic acid receptor 6 (LPAR6) transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LPAR6 (NM_001162497) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LPAR6 (NM_001162498) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LPAR6 (NM_005767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack