USD 420.00
In Stock
GIPR (Myc-DDK-tagged)-Human gastric inhibitory polypeptide receptor (GIPR)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
GIPR (Myc-DDK-tagged)-Human gastric inhibitory polypeptide receptor (GIPR)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 760.00
In Stock
GIPR (untagged)-Human gastric inhibitory polypeptide receptor (GIPR)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 460.00
In Stock
GIPR (GFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GIPR (Myc-DDK tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, GIPR (mGFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, GIPR (Myc-DDK tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, GIPR (mGFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 396.00
2 Weeks
Transient overexpression lysate of gastric inhibitory polypeptide receptor (GIPR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 768.00
In Stock
Lenti ORF clone of Human gastric inhibitory polypeptide receptor (GIPR), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 768.00
In Stock
Lenti ORF clone of Human gastric inhibitory polypeptide receptor (GIPR), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
In Stock
Lenti ORF clone of Human gastric inhibitory polypeptide receptor (GIPR), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 345.00
In Stock
Rabbit polyclonal anti-GIPR antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GIPR. |
USD 450.00
5 Days
Rabbit polyclonal GIPR Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR. |
USD 121.00
In Stock
GIPR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 450.00
2 Weeks
Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 113~142 amino acids from the Center region of Human GIPR. |
USD 425.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GIPR / GIP Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GIPR. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Panda, Dog, Bat (94%); Bovine, Rabbit, Horse (89%). |
USD 375.00
5 Days
Rabbit Polyclonal Anti-GIPR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA |
USD 345.00
In Stock
Rabbit Polyclonal Anti-GIPR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GIPR |
USD 360.00
5 Days
GIPR Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack