Products

View as table Download

Lenti ORF particles, GIPR (Myc-DDK tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GIPR (mGFP-tagged) - Human gastric inhibitory polypeptide receptor (GIPR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of gastric inhibitory polypeptide receptor (GIPR)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Lenti ORF clone of Human gastric inhibitory polypeptide receptor (GIPR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal anti-GIPR antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIPR.

Rabbit polyclonal GIPR Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR.

Gastric Inhibitory Polypeptide Receptor (GIPR) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 113~142 amino acids from the Center region of Human GIPR.

Rabbit Polyclonal Anti-GIPR Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GIPR / GIP Receptor antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GIPR. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Panda, Dog, Bat (94%); Bovine, Rabbit, Horse (89%).

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA

Rabbit Polyclonal Anti-GIPR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GIPR

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of GIPR (NM_000164) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack