Germany
Japan
United Kingdom
China
GPR12 (Myc-DDK-tagged)-Human G protein-coupled receptor 12 (GPR12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GPR12 (Myc-DDK tagged) - Human G protein-coupled receptor 12 (GPR12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPR12 (mGFP-tagged) - Human G protein-coupled receptor 12 (GPR12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GPR12 (GFP-tagged) - Human G protein-coupled receptor 12 (GPR12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor 12 (GPR12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR12 (Myc-DDK tagged) - Human G protein-coupled receptor 12 (GPR12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 12 (GPR12), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR12 (mGFP-tagged) - Human G protein-coupled receptor 12 (GPR12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 12 (GPR12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GPR12 (untagged)-Human G protein-coupled receptor 12 (GPR12)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor 12 (GPR12), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-GPR12 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR12. |
Rabbit Polyclonal Anti-GPR12 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR12 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Panda, Dog, Pig (94%); Hamster, Elephant, Bat, Horse, Rabbit, Opossum, Turkey (88%); Rat, Bovine, Chicken, Platypus, Xenopus, Stickleback (81%). |
Transient overexpression lysate of G protein-coupled receptor 12 (GPR12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-GPR12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR12 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR12. Synthetic peptide located within the following region: SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY |
Rabbit Polyclonal Anti-GPR12 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR12 antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Panda, Horse, Pig, Opossum (100%); Bat, Elephant, Rabbit (94%); Turkey, Chicken (88%); Platypus, Xenopus (81%). |
GPR12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression of GPR12 (NM_005288) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR12 (NM_005288) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR12 (NM_005288) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPR12
Families
- GPCR