GPR173 (Myc-DDK-tagged)-Human G protein-coupled receptor 173 (GPR173)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPR173 (Myc-DDK-tagged)-Human G protein-coupled receptor 173 (GPR173)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPR173 (GFP-tagged) - Human G protein-coupled receptor 173 (GPR173)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human G protein-coupled receptor 173 (GPR173), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GPR173 (Myc-DDK tagged) - Human G protein-coupled receptor 173 (GPR173), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human G protein-coupled receptor 173 (GPR173), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GPR173 (mGFP-tagged) - Human G protein-coupled receptor 173 (GPR173), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPR173 (untagged)-Human G protein-coupled receptor 173 (GPR173)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GPR173 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-GPR173 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Transient overexpression lysate of G protein-coupled receptor 173 (GPR173)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-GPR173 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit Polyclonal Anti-GPR173 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV |
Rabbit Polyclonal Anti-GPR173 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Rabbit (100%); Mouse, Rat, Hamster, Bovine (95%). |
Rabbit Polyclonal Anti-GPR173 Antibody (Transmembrane Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from 5th transmembrane domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Rabbit (100%); Opossum (95%). |
Rabbit Polyclonal Anti-GPR173 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GPR173 / SREB3 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Rabbit (100%); Panda (95%); Hamster, Elephant (90%). |
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR173 (NM_018969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack