Germany
Japan
United Kingdom
China
GPR18 (Myc-DDK-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GPR18 (Myc-DDK-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR18 (GFP-tagged) - Human G protein-coupled receptor 18 (GPR18), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GPR18 (Myc-DDK-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR18 (Myc-DDK-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GPR18 (mGFP-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 18 (GPR18), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR18 (Myc-DDK tagged) - Human G protein-coupled receptor 18 (GPR18), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 18 (GPR18), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR18 (mGFP-tagged) - Human G protein-coupled receptor 18 (GPR18), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR18 (GFP-tagged) - Human G protein-coupled receptor 18 (GPR18), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR18 (untagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPR18 (mGFP-tagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of G protein-coupled receptor 18 (GPR18), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPR18 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPR18 (untagged)-Human G protein-coupled receptor 18 (GPR18), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GPR18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR18 antibody: synthetic peptide directed towards the middle region of human GPR18. Synthetic peptide located within the following region: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT |
Rabbit Polyclonal Anti-GPR18 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 14 amino acid peptide from 2nd cytoplasmic domain of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Elephant (93%); Bat (86%). |
Rabbit Polyclonal Anti-GPR18 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Horse, Rabbit, Pufferfish (100%); Mouse, Rat, Bovine, Pig, Opossum, Salmon, Zebrafish, Stickleback (94%); Chicken, Platypus, Lizard, Catfish (88%); Hamster, Turkey (81%). |
Rabbit Polyclonal Anti-GPR18 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPCRW / GPR18 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR18. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Hamster, Horse, Pig, Opossum (94%); Mouse, Rat, Bat (89%); Elephant, Rabbit (83%). |
Transient overexpression of GPR18 (NM_005292) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR18 (NM_001098200) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR18 (NM_005292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR18 (NM_005292) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPR18 (NM_001098200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR18 (NM_001098200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPR18
Families
- GPCR