Germany
Japan
United Kingdom
China
GPR78 (Myc-DDK-tagged)-Human G protein-coupled receptor 78 (GPR78)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GPR78 (Myc-DDK tagged) - Human G protein-coupled receptor 78 (GPR78), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPR78 (mGFP-tagged) - Human G protein-coupled receptor 78 (GPR78), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GPR78 (GFP-tagged) - Human G protein-coupled receptor 78 (GPR78)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor 78 (GPR78), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR78 (Myc-DDK tagged) - Human G protein-coupled receptor 78 (GPR78), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 78 (GPR78), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR78 (mGFP-tagged) - Human G protein-coupled receptor 78 (GPR78), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 78 (GPR78), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GPR78 (untagged)-Human G protein-coupled receptor 78 (GPR78)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor 78 (GPR78), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of G protein-coupled receptor 78 (GPR78)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPR78 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | GPR78 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR78. Percent identity with other species by BLAST analysis: Human, Gorilla (100%). |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: ILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSS |
GPR78 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR78 |
Transient overexpression of GPR78 (NM_080819) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPR78 (NM_080819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPR78 (NM_080819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPR78
Families
- GPCR