Products

cDNA Clones (14)
Proteins (10)
Antibodies (4)
Jump to Filters
View as table Download
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Tagged ORF Clone
RG202433

USD 460.00

In Stock

LTB4R (GFP-tagged) - Human leukotriene B4 receptor (LTB4R), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Tagged ORF Clone Lentiviral Particle
RC202433L3V

USD 820.00

6 Weeks

Lenti ORF particles, LTB4R (Myc-DDK tagged) - Human leukotriene B4 receptor (LTB4R), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Tagged ORF Clone Lentiviral Particle
RC202433L4V

USD 820.00

6 Weeks

Lenti ORF particles, LTB4R (mGFP-tagged) - Human leukotriene B4 receptor (LTB4R), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Tagged ORF Clone Lentiviral Particle
RC227473L3V

USD 820.00

6 Weeks

Lenti ORF particles, LTB4R (Myc-DDK tagged) - Human leukotriene B4 receptor (LTB4R), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Tagged ORF Clone Lentiviral Particle
RC227473L4V

USD 820.00

6 Weeks

Lenti ORF particles, LTB4R (mGFP-tagged) - Human leukotriene B4 receptor (LTB4R), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Untagged Clone
SC319120

USD 310.00

In Stock

LTB4R (untagged)-Human leukotriene B4 receptor (LTB4R), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Over-expression Lysate
LC403631

USD 121.00

In Stock

LTB4R HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Over-expression Lysate
LY403631

USD 396.00

5 Days

Transient overexpression lysate of leukotriene B4 receptor (LTB4R), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Leukotriene B4 Receptor (LTB4R) Rabbit Polyclonal Antibody
TA328655

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Human BLT1 (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide CFPRYPSEGHRAFH, corresponding to amino acid residues 168-181 of human BLT1. 2nd extracellular loop.
Leukotriene B4 Receptor (LTB4R) Rabbit Polyclonal Antibody
TA310062

USD 205.00

3 Weeks

Rabbit anti-LTB4R polyclonal antibody

Applications WB
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human BLT1 Receptor.
Leukotriene B4 Receptor (LTB4R) Rabbit Polyclonal Antibody
TA329185

USD 375.00

5 Days

Rabbit Polyclonal anti-LTB4R antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTB4R antibody: synthetic peptide directed towards the C terminal of human LTB4R. Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
Leukotriene B4 Receptor (LTB4R) Rabbit Polyclonal Antibody
TA340551

USD 425.00

5 Days

Rabbit Polyclonal Anti-LTB4R Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Leukotriene B4 Receptor / BLT1 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human Leukotriene B4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Horse, Rabbit (100%); Bovine (88%); Opossum, Platypus (81%).
Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Over-expression Lysate
LY428406

USD 396.00

5 Days

Transient overexpression lysate of leukotriene B4 receptor (LTB4R), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Leukotriene B4 Receptor (LTB4R) ICC Control Block
TB402433

USD 1,070.00

4 Weeks

Transient overexpression of LTB4R (NM_181657) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Leukotriene B4 Receptor (LTB4R) ICC Control Block
TB427473

USD 1,070.00

4 Weeks

Transient overexpression of LTB4R (NM_001143919) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Leukotriene B4 Receptor (LTB4R) Cytosection
TS402433

USD 225.00

4 Weeks

Transient overexpression of LTB4R (NM_181657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Leukotriene B4 Receptor (LTB4R) Cytosection
TS402433P5

USD 889.00

4 Weeks

Transient overexpression of LTB4R (NM_181657) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Leukotriene B4 Receptor (LTB4R) Cytosection
TS427473

USD 225.00

4 Weeks

Transient overexpression of LTB4R (NM_001143919) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Leukotriene B4 Receptor (LTB4R) Cytosection
TS427473P5

USD 889.00

4 Weeks

Transient overexpression of LTB4R (NM_001143919) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack