Products

View as table Download

P2RY6 (Myc-DDK-tagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

P2RY6 (Myc-DDK-tagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

P2RY6 (Myc-DDK-tagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

P2RY6 (Myc-DDK-tagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, P2RY6 (Myc-DDK tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, P2RY6 (mGFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

P2RY6 (GFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (myc-DDK-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (myc-DDK-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (myc-DDK-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (myc-DDK-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (myc-DDK-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (GFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (GFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, P2RY6 (Myc-DDK tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (mGFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (Myc-DDK tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (mGFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (Myc-DDK tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (mGFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (Myc-DDK tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, P2RY6 (mGFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

P2RY6 (GFP-tagged) - Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

P2RY6 (untagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

P2RY6 (untagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

P2RY6 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human P2RY6

P2RY6 (untagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

P2RY6 (untagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

P2RY6 (untagged)-Human pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-P2RY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY6 antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY6. Synthetic peptide located within the following region: NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

P2RY6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406124 is the same product as LY430452.

Transient overexpression lysate of pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406125 is the same product as LY430453.

Transient overexpression lysate of pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of pyrimidinergic receptor P2Y, G-protein coupled, 6 (P2RY6), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB